Lineage for d1f4hb3 (1f4h B:3-219)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1116326Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1116327Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1116431Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 1116432Protein beta-Galactosidase [49804] (2 species)
  7. 1116440Species Escherichia coli [TaxId:562] [49805] (25 PDB entries)
    Uniprot P00722
  8. 1116530Domain d1f4hb3: 1f4h B:3-219 [23763]
    Other proteins in same PDB: d1f4ha1, d1f4ha2, d1f4ha4, d1f4ha5, d1f4hb1, d1f4hb2, d1f4hb4, d1f4hb5, d1f4hc1, d1f4hc2, d1f4hc4, d1f4hc5, d1f4hd1, d1f4hd2, d1f4hd4, d1f4hd5
    complexed with mg

Details for d1f4hb3

PDB Entry: 1f4h (more details), 2.8 Å

PDB Description: e. coli (lacz) beta-galactosidase (orthorhombic)
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d1f4hb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4hb3 b.18.1.5 (B:3-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d1f4hb3:

Click to download the PDB-style file with coordinates for d1f4hb3.
(The format of our PDB-style files is described here.)

Timeline for d1f4hb3: