Lineage for d1f4ad3 (1f4a D:3-219)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1530204Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1530205Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1530315Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 1530316Protein beta-Galactosidase [49804] (2 species)
  7. 1530324Species Escherichia coli [TaxId:562] [49805] (41 PDB entries)
    Uniprot P00722
  8. 1530484Domain d1f4ad3: 1f4a D:3-219 [23761]
    Other proteins in same PDB: d1f4aa1, d1f4aa2, d1f4aa4, d1f4aa5, d1f4ab1, d1f4ab2, d1f4ab4, d1f4ab5, d1f4ac1, d1f4ac2, d1f4ac4, d1f4ac5, d1f4ad1, d1f4ad2, d1f4ad4, d1f4ad5
    complexed with mg

Details for d1f4ad3

PDB Entry: 1f4a (more details), 2.8 Å

PDB Description: e. coli (lacz) beta-galactosidase (ncs constrained monomer- orthorhombic)
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d1f4ad3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4ad3 b.18.1.5 (D:3-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d1f4ad3:

Click to download the PDB-style file with coordinates for d1f4ad3.
(The format of our PDB-style files is described here.)

Timeline for d1f4ad3: