Lineage for d4g6ib1 (4g6i B:1-96)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793458Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2793672Family b.43.4.0: automated matches [227162] (1 protein)
    not a true family
  6. 2793673Protein automated matches [226870] (22 species)
    not a true protein
  7. 2793681Species Brucella abortus [TaxId:235] [228298] (4 PDB entries)
  8. 2793690Domain d4g6ib1: 4g6i B:1-96 [237582]
    automated match to d4e0fb1
    complexed with rs3

Details for d4g6ib1

PDB Entry: 4g6i (more details), 1.78 Å

PDB Description: Crystallographic structure of trimeric riboflavin synthase from Brucella abortus in complex with roseoflavin
PDB Compounds: (B:) Riboflavin synthase subunit alpha

SCOPe Domain Sequences for d4g6ib1:

Sequence, based on SEQRES records: (download)

>d4g6ib1 b.43.4.0 (B:1-96) automated matches {Brucella abortus [TaxId: 235]}
mftgiitdigkvdrvkplnegvllrietaydpetielgasiacsgvcltvvalpekgsna
rwfeveaweealrlttisswqsgrkinlerslklgd

Sequence, based on observed residues (ATOM records): (download)

>d4g6ib1 b.43.4.0 (B:1-96) automated matches {Brucella abortus [TaxId: 235]}
mftgiitdigkvdrvkplnegvllrietaydpetielgasiacsgvcltvvalpnarwfe
veaweealrlttisswqsgrkinlerslklgd

SCOPe Domain Coordinates for d4g6ib1:

Click to download the PDB-style file with coordinates for d4g6ib1.
(The format of our PDB-style files is described here.)

Timeline for d4g6ib1: