SCOPe 2.03: Domain d4g6ia1: 4g6i A:1-96

Lineage for d4g6ia1 (4g6i A:1-96)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.0: automated matches [227162] (1 protein)
   not a true family

6. Protein automated matches [226870] (15 species)
   not a true protein

7. Species Brucella abortus [TaxId:235] [228298] (4 PDB entries)

8. Domain d4g6ia1: 4g6i A:1-96 [237579]
   automated match to d4e0fa1
   complexed with rs3

Details for d4g6ia1

PDB Entry: 4g6i, 1.78 Å

PDB Description: Crystallographic structure of trimeric riboflavin synthase from Brucella abortus in complex with roseoflavin

PDB Compounds: (A:) Riboflavin synthase subunit alpha

SCOPe Domain Sequences for d4g6ia1:

Sequence; same for both SEQRES and ATOM records:

>d4g6ia1 b.43.4.0 (A:1-96) automated matches {Brucella abortus [TaxId: 235]}
mftgiitdigkvdrvkplnegvllrietaydpetielgasiacsgvcltvvalpekgsna
rwfeveaweealrlttisswqsgrkinlerslklgd

Timeline for d4g6ia1:

• d4g6ia1 is new in SCOPe 2.03-stable
  
• d4g6ia1 appears in SCOPe 2.04
  
• d4g6ia1 appears in the current release, SCOPe 2.08