Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.6: Leukocidin-like [56958] (1 superfamily) subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel |
Superfamily f.6.1: Leukocidin-like [56959] (3 families) |
Family f.6.1.0: automated matches [227293] (1 protein) not a true family |
Protein automated matches [227114] (2 species) not a true protein |
Species Staphylococcus phage [TaxId:71366] [236419] (5 PDB entries) |
Domain d4iycc_: 4iyc C: [237574] automated match to d4iyca_ mutant |
PDB Entry: 4iyc (more details), 2.75 Å
SCOPe Domain Sequences for d4iycc_:
Sequence, based on SEQRES records: (download)
>d4iycc_ f.6.1.0 (C:) automated matches {Staphylococcus phage [TaxId: 71366]} nienigdgaevvkrtedtssdkwgvtqniqfdfvkdkkynkdalilkmqgfinskttyyn ykntdhikamrwpfqyniglktndpnvdlinylpknkidsvnvsqtlgyniggnfnsgps tggngsfnysktisynqqnyisevehqnsksvqwgikansfitslgkmsghdpnlfvgyk pysqnprdyfvpdnelpplvhsgfnpsfiatvshekgsgdtsefeitygrnmdvthatrr tahygnsylegsrihnafvnrnytvkyevnwktheikvkghn
>d4iycc_ f.6.1.0 (C:) automated matches {Staphylococcus phage [TaxId: 71366]} nienigdgaevvkrtedtssdkwgvtqniqfdfvkdkkynkdalilkmqgfinskttyyn ykntdhikamrwpfqyniglktndpnvdlinylpknkidsvnvsqtlgyniggnfnsgps tggsfnysktisynqqnyisevehqnsksvqwgikansfitslgkmsghdpnlfvgykpy sqnprdyfvpdnelpplvhsgfnpsfiatvshekgsgdtsefeitygrnmdvthatrrta hygnsylegsrihnafvnrnytvkyevnwktheikvkghn
Timeline for d4iycc_: