Lineage for d3w7eb_ (3w7e B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1338072Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 1338073Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 1338358Protein automated matches [190228] (10 species)
    not a true protein
  7. 1338407Species Trypanosoma cruzi [TaxId:5693] [187324] (54 PDB entries)
  8. 1338441Domain d3w7eb_: 3w7e B: [237484]
    automated match to d3w1aa_
    complexed with fmn, gol, nco, w7f

Details for d3w7eb_

PDB Entry: 3w7e (more details), 1.56 Å

PDB Description: structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-5-179
PDB Compounds: (B:) Dihydroorotate dehydrogenase (fumarate)

SCOPe Domain Sequences for d3w7eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w7eb_ c.1.4.1 (B:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
mclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpeprym
afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe
kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa
vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr
cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr
tleefrgrvktie

SCOPe Domain Coordinates for d3w7eb_:

Click to download the PDB-style file with coordinates for d3w7eb_.
(The format of our PDB-style files is described here.)

Timeline for d3w7eb_: