SCOPe 2.03: Domain d4ovhb2: 4ovh B:123-244

Lineage for d4ovhb2 (4ovh B:123-244)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein)
   duplication: consists of three domains of this fold

6. Protein DNA polymerase III, beta subunit [55981] (2 species)

7. Species Escherichia coli [TaxId:562] [55982] (30 PDB entries)
   Uniprot P00583

8. Domain d4ovhb2: 4ovh B:123-244 [237430]
   automated match to d3d1ga2
   complexed with 2ve, ca, cl, peg, pg4

Details for d4ovhb2

PDB Entry: 4ovh, 2.25 Å

PDB Description: e. coli sliding clamp in complex with (r)-6-bromo-9-(2- (carboxymethylamino)-2-oxoethyl)-2,3,4,9-tetrahydro-1h-carbazole-2- carboxylic acid

PDB Compounds: (B:) DNA polymerase III subunit beta

SCOPe Domain Sequences for d4ovhb2:

Sequence; same for both SEQRES and ATOM records:

>d4ovhb2 d.131.1.1 (B:123-244) DNA polymerase III, beta subunit {Escherichia coli [TaxId: 562]}
qseveftlpqatmkrlieatqfsmahqdvryylngmlfetegeelrtvatdghrlavcsm
pigqslpshsvivprkgvielmrmldggdnplrvqigsnnirahvgdfiftsklvdgrfp
dy

Timeline for d4ovhb2:

• d4ovhb2 is new in SCOPe 2.03-stable
  
• d4ovhb2 appears in SCOPe 2.04
  
• d4ovhb2 appears in the current release, SCOPe 2.08