Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) automatically mapped to Pfam PF00091 |
Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
Protein automated matches [226837] (7 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226564] (48 PDB entries) |
Domain d4o4ha1: 4o4h A:1-245 [237359] Other proteins in same PDB: d4o4ha2, d4o4hb2, d4o4hc2, d4o4hd2, d4o4he_, d4o4hf1, d4o4hf2, d4o4hf3 automated match to d3rycc1 complexed with acp, ca, gdp, gol, gtp, llm, mg |
PDB Entry: 4o4h (more details), 2.1 Å
SCOPe Domain Sequences for d4o4ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o4ha1 c.32.1.1 (A:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]} mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita slrfd
Timeline for d4o4ha1: