SCOPe 2.03: Domain d4neee_: 4nee E:

Lineage for d4neee_ (4nee E:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.102: Regulatory factor Nef [55670] (1 superfamily)
   alpha(2)-beta(4)-alpha; 3 layers: alpha/beta/alpha

4. Superfamily d.102.1: Regulatory factor Nef [55671] (2 families)

5. Family d.102.1.0: automated matches [191617] (1 protein)
   not a true family

6. Protein automated matches [191127] (2 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [236469] (1 PDB entry)

8. Domain d4neee_: 4nee E: [237333]
   automated match to d4neec1

Details for d4neee_

PDB Entry: 4nee, 2.88 Å

PDB Description: crystal structure of AP-2 alpha/simga2 complex bound to HIV-1 Nef

PDB Compounds: (E:) Protein Nef

SCOPe Domain Sequences for d4neee_:

Sequence, based on SEQRES records:

>d4neee_ d.102.1.0 (E:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
xxxxxxxeeevgfpvtpqvplrpmtykaavdlshflkekggleglihsqrrqdildlwiy
htqgyfpdwqnytpgpgvrypltfgwcyklvpvepdkveeankgentsllhpvslhgmdd
perevlewrfdsrlafhhvarelhpeyf

Sequence, based on observed residues (ATOM records):

>d4neee_ d.102.1.0 (E:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
xxxxxxxpqvplrpmtykaavdlshflkekggleglihsqrrqdildlwiyhtqgyfpdw
qnytpgpgvrypltfgwcyklvpvepdkveeankgentsllhpvslhgmddperevlewr
fdsrlafhhvarelhpeyf

Timeline for d4neee_:

• d4neee_ is new in SCOPe 2.03-stable
  
• d4neee_ appears in SCOPe 2.04
  
• d4neee_ appears in the current release, SCOPe 2.08, called d4neee1