Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) duplication contains two domains of this fold |
Family c.55.1.14: Fumble-like [159623] (4 proteins) Pfam PF03630; type II pantothenate kinase-like |
Protein automated matches [232925] (2 species) not a true protein |
Species Staphylococcus aureus [TaxId:282458] [237327] (1 PDB entry) |
Domain d4nb4c_: 4nb4 C: [237331] automated match to d2ewsa1 complexed with adp, mg, sh3 |
PDB Entry: 4nb4 (more details), 2.25 Å
SCOPe Domain Sequences for d4nb4c_:
Sequence, based on SEQRES records: (download)
>d4nb4c_ c.55.1.14 (C:) automated matches {Staphylococcus aureus [TaxId: 282458]} gmkvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviae ninipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigt gggmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghv lhhldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvved ytvlrgckpyyvengafsgaigalylek
>d4nb4c_ c.55.1.14 (C:) automated matches {Staphylococcus aureus [TaxId: 282458]} gmkvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviae ninipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigt gggmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykeppipgdltaanfghvlh hlddftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedytv lrgckpyyvengafsgaigalylek
Timeline for d4nb4c_:
View in 3D Domains from other chains: (mouse over for more information) d4nb4a_, d4nb4b_, d4nb4d_, d4nb4e_ |