Lineage for d4mqob_ (4mqo B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1379866Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1379867Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1380996Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1380997Protein automated matches [190151] (66 species)
    not a true protein
  7. 1381233Species Mycobacterium tuberculosis [TaxId:1773] [225404] (11 PDB entries)
  8. 1381246Domain d4mqob_: 4mqo B: [237318]
    automated match to d3tftb_
    complexed with 2b0, 2bg, edo, so4

Details for d4mqob_

PDB Entry: 4mqo (more details), 1.7 Å

PDB Description: mycobaterium tuberculosis transaminase bioa complexed with 5,6-dihydro-benzo[h]cinnolin-3-ylamine
PDB Compounds: (B:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase

SCOPe Domain Sequences for d4mqob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mqob_ c.67.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
gltpeqiiavdgahlwhpyssigreavspvvavaahgawltlirdgqpievldamsswwt
aihghghpaldqalttqlrvmnhvmfgglthepaarlakllvditpagldtvffsdsgsv
svevaakmalqywrgrglpgkrrlmtwrggyhgdtflamsicdphggmhslwtdvlaaqv
fapqvprdydpaysaafeaqlaqhagelaavvvepvvqgaggmrfhdprylhdlrdicrr
yevllifdeiatgfgrtgalfaadhagvspdimcvgkaltggylslaatlctadvahtis
agaagalmhgptfmanplacavsvasvelllgqdwrtritelaagltagldtaralpavt
dvrvcgaigviecdrpvdlavatpaaldrgvwlrpfrnlvyamppyictpaeitqitsam
vevarlv

SCOPe Domain Coordinates for d4mqob_:

Click to download the PDB-style file with coordinates for d4mqob_.
(The format of our PDB-style files is described here.)

Timeline for d4mqob_: