Lineage for d4mf9a_ (4mf9 A:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1454730Fold e.62: Heme iron utilization protein-like [144063] (1 superfamily)
    2 domains; d1 - 3-helical bundle similar to the homeodomain-like fold; d2 - 6-stranded beta-barrel capped by two helices at one end, similar topology to the PH-like fold
  4. 1454731Superfamily e.62.1: Heme iron utilization protein-like [144064] (3 families) (S)
  5. 1454746Family e.62.1.0: automated matches [227944] (1 protein)
    not a true family
  6. 1454747Protein automated matches [227945] (1 species)
    not a true protein
  7. 1454748Species Pseudomonas aeruginosa [TaxId:287] [227946] (2 PDB entries)
  8. 1454751Domain d4mf9a_: 4mf9 A: [237310]
    automated match to d4imha_
    complexed with hem

Details for d4mf9a_

PDB Entry: 4mf9 (more details), 1.95 Å

PDB Description: crystal structure of holo-phus, a heme-binding protein from pseudomonas aeruginosa
PDB Compounds: (A:) Hemin degrading factor

SCOPe Domain Sequences for d4mf9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mf9a_ e.62.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
hspaelyrawqdlraerpqlrardaaallqvsegelvasrvgidavrlrpdwaallpalg
elgpimaltrnehcvherkgpyrevtvsangqmglvvspdidlrlflggwnavfaiaeet
argtqrsiqvfdqqgvavhkvflaeasdvraweplverlraaeqdavlalheprapaaal
vdaqidaaalregwaalkdthhfhallkkhgaqrtqalrlaggewaerldngdlaklfea
aaesglpimvfvgnahciqihtgpvcnlkwlddwfnvldpefnlhlkttgiaelwrvrkp
stdgivtsweafdpdgelivqlfgarkpgeperddwrelaesfkal

SCOPe Domain Coordinates for d4mf9a_:

Click to download the PDB-style file with coordinates for d4mf9a_.
(The format of our PDB-style files is described here.)

Timeline for d4mf9a_: