Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
Fold e.62: Heme iron utilization protein-like [144063] (1 superfamily) 2 domains; d1 - 3-helical bundle similar to the homeodomain-like fold; d2 - 6-stranded beta-barrel capped by two helices at one end, similar topology to the PH-like fold |
Superfamily e.62.1: Heme iron utilization protein-like [144064] (3 families) |
Family e.62.1.0: automated matches [227944] (1 protein) not a true family |
Protein automated matches [227945] (1 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [227946] (2 PDB entries) |
Domain d4mf9a_: 4mf9 A: [237310] automated match to d4imha_ complexed with hem |
PDB Entry: 4mf9 (more details), 1.95 Å
SCOPe Domain Sequences for d4mf9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mf9a_ e.62.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} hspaelyrawqdlraerpqlrardaaallqvsegelvasrvgidavrlrpdwaallpalg elgpimaltrnehcvherkgpyrevtvsangqmglvvspdidlrlflggwnavfaiaeet argtqrsiqvfdqqgvavhkvflaeasdvraweplverlraaeqdavlalheprapaaal vdaqidaaalregwaalkdthhfhallkkhgaqrtqalrlaggewaerldngdlaklfea aaesglpimvfvgnahciqihtgpvcnlkwlddwfnvldpefnlhlkttgiaelwrvrkp stdgivtsweafdpdgelivqlfgarkpgeperddwrelaesfkal
Timeline for d4mf9a_: