SCOPe 2.03: Domain d4m6ub1: 4m6u B:3-132

Lineage for d4m6ub1 (4m6u B:3-132)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (55 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:303] [228629] (5 PDB entries)

8. Domain d4m6ub1: 4m6u B:3-132 [237298]
   Other proteins in same PDB: d4m6ua2, d4m6ub2
   automated match to d3uxkd1
   complexed with mg, ttn

Details for d4m6ub1

PDB Entry: 4m6u, 1.8 Å

PDB Description: p. putida mandelate racemase co-crystallized with tartronic acid

PDB Compounds: (B:) mandelate racemase

SCOPe Domain Sequences for d4m6ub1:

Sequence; same for both SEQRES and ATOM records:

>d4m6ub1 d.54.1.0 (B:3-132) automated matches {Pseudomonas putida [TaxId: 303]}
evlitglrtravnvplaypvhtavgtvgtaplvlidlatsagvvghsylfaytpvalksl
kqllddmaamivneplapvsleamlakrfclagytglirmaaagidmaawdalgkvhetp
lvkllganar

Timeline for d4m6ub1:

• d4m6ub1 is new in SCOPe 2.03-stable
  
• d4m6ub1 appears in SCOPe 2.04
  
• d4m6ub1 appears in the current release, SCOPe 2.08