Lineage for d4lifa_ (4lif A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1423212Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 1423213Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) (S)
  5. 1423214Family d.89.1.1: The origin DNA-binding domain of SV40 T-antigen [55465] (2 proteins)
  6. 1423215Protein The origin DNA-binding domain of SV40 T-antigen [55466] (2 species)
  7. 1423216Species Jc polyomavirus [TaxId:10632] [237285] (3 PDB entries)
  8. 1423220Domain d4lifa_: 4lif A: [237286]
    automated match to d1tbda_
    complexed with so4

Details for d4lifa_

PDB Entry: 4lif (more details), 2.6 Å

PDB Description: Crystal structure of the JCV large T-antigen origin binding domain
PDB Compounds: (A:) large t antigen

SCOPe Domain Sequences for d4lifa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lifa_ d.89.1.1 (A:) The origin DNA-binding domain of SV40 T-antigen {Jc polyomavirus [TaxId: 10632]}
vedpkdfpvdlhaflsqavfsnrtvasfavyttkekaqilykklmekysvtfisrhgfgg
hnilffltphrhrvsainnycqklctfsflickgvnkeylfysalcrqpyavveesiqgg
lkehdfn

SCOPe Domain Coordinates for d4lifa_:

Click to download the PDB-style file with coordinates for d4lifa_.
(The format of our PDB-style files is described here.)

Timeline for d4lifa_: