Lineage for d4kvga_ (4kvg A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1362829Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1363774Protein automated matches [190047] (16 species)
    not a true protein
  7. 1363812Species Human (Homo sapiens) [TaxId:9606] [186768] (113 PDB entries)
  8. 1363895Domain d4kvga_: 4kvg A: [237284]
    automated match to d1c1ya_
    complexed with edo, gtp, mg

Details for d4kvga_

PDB Entry: 4kvg (more details), 1.65 Å

PDB Description: Crystal structure of RIAM RA-PH domains in complex with GTP bound Rap1
PDB Compounds: (A:) ras-related protein rap-1a

SCOPe Domain Sequences for d4kvga_:

Sequence, based on SEQRES records: (download)

>d4kvga_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmreyklvvlgsvgvgksaltvqfvqgifvekydptiedsyrkqvevdcqqcmleildta
gteeftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtedvpmilvgnkcd
ledervvgkeqgqnlarqwcncaflessakskinvneifydlvrqinr

Sequence, based on observed residues (ATOM records): (download)

>d4kvga_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmreyklvvlgsvgvgksaltvqfvqgifvekydptiedsyrkqvevdcqqcmleildta
gttamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtedvpmilvgnkcdled
ervvgkeqgqnlarqwcncaflessakskinvneifydlvrqinr

SCOPe Domain Coordinates for d4kvga_:

Click to download the PDB-style file with coordinates for d4kvga_.
(The format of our PDB-style files is described here.)

Timeline for d4kvga_:

  • d4kvga_ appears in periodic updates to SCOPe 2.03 starting on 2014-03-07
  • d4kvga_ appears in SCOPe 2.04
  • d4kvga_ appears in the current release, SCOPe 2.07, called d4kvga1