Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (52 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [231543] (2 PDB entries) |
Domain d4jb6b1: 4jb6 B:2-254 [237279] automated match to d2bywa1 complexed with k; mutant |
PDB Entry: 4jb6 (more details), 2.4 Å
SCOPe Domain Sequences for d4jb6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jb6b1 c.95.1.0 (B:2-254) automated matches {Pseudomonas aeruginosa [TaxId: 287]} srrrvvitgmgmlsplgldvpsswegilagrsgiapiehmdlsaystrfggsvkgfnvee ylsakearkldlfiqyglaasfqavrdsglevtdanrerigvsmgsgiggltnienncrs lfeqgprrispffvpgsiinmvsgflsihlglqgpnyalttaqttgthsigmaarniayg eadvmvaggsemaacglglggfgaaralstrndeptrasrpwdrdrdgfvlsdgsgalvl eeleharargari
Timeline for d4jb6b1: