SCOPe 2.08: Domain d4c7kd_: 4c7k D:

Lineage for d4c7kd_ (4c7k D:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein automated matches [190085] (59 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186828] (21 PDB entries)

8. Domain d4c7kd_: 4c7k D: [237247]
   automated match to d3pdjb_
   complexed with dzl, nap

Details for d4c7kd_

PDB Entry: 4c7k, 1.91 Å

PDB Description: 11b-hydroxysteroid dehydrogenase type i in complex with inhibitor

PDB Compounds: (D:) Corticosteroid 11-beta-dehydrogenase isozyme 1

SCOPe Domain Sequences for d4c7kd_:

Sequence; same for both SEQRES and ATOM records:

>d4c7kd_ c.2.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaas
ahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnfl
syvvltvaalpmlkqsngsivvvsslagkvayplvaaysaskfaldgffssirkeysvsr
vnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydssrwtt
llirnpsrkileelysts

Timeline for d4c7kd_:

• d4c7kd_ first appeared in SCOPe 2.03
  
• d4c7kd_ appears in SCOPe 2.07