Lineage for d4od1l1 (4od1 L:3-107)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1766221Domain d4od1l1: 4od1 L:3-107 [237228]
    Other proteins in same PDB: d4od1l2
    automated match to d2mcg11

Details for d4od1l1

PDB Entry: 4od1 (more details), 2.69 Å

PDB Description: Crystal structure of human Fab CAP256-VRC26.03, a potent V1V2-directed HIV-1 neutralizing antibody
PDB Compounds: (L:) CAP256-VRC26.03 light chain

SCOPe Domain Sequences for d4od1l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4od1l1 b.1.1.0 (L:3-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqppsvsaapgqkvtiscsgsssnignnfvswyqqrpgtapkiliyennkrpsetpdr
fsgsksgtsatlaitglqtadeaeyycatwsaslssarvfgtgtritvlg

SCOPe Domain Coordinates for d4od1l1:

Click to download the PDB-style file with coordinates for d4od1l1.
(The format of our PDB-style files is described here.)

Timeline for d4od1l1: