SCOPe 2.03: Domain d4o0va_: 4o0v A:

Lineage for d4o0va_ (4o0v A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (314 PDB entries)

8. Domain d4o0va_: 4o0v A: [237208]
   automated match to d4o0xa_
   complexed with 2ol

Details for d4o0va_

PDB Entry: 4o0v, 2.8 Å

PDB Description: Back pocket flexibility provides group-II PAK selectivity for type 1 kinase inhibitors

PDB Compounds: (A:) serine/threonine-protein kinase pak 4

SCOPe Domain Sequences for d4o0va_:

Sequence; same for both SEQRES and ATOM records:

>d4o0va_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsheqfraalqlvvdpgdprsyldnfikigegstgivciatvrssgklvavkkmdlrkqq
rrellfnevvimrdyqhenvvemynsylvgdelwvvmefleggaltdivthtrmneeqia
avclavlqalsvlhaqgvihrdiksdsillthdgrvklsdfgfcaqvskevprrkslvgt
pywmapelisrlpygpevdiwslgimviemvdgeppyfnepplkamkmirdnlpprlknl
hkvspslkgfldrllvrdpaqrataaellkhpflakagppasivplmrqnr

Timeline for d4o0va_:

• d4o0va_ is new in SCOPe 2.03-stable
  
• d4o0va_ appears in SCOPe 2.04
  
• d4o0va_ appears in the current release, SCOPe 2.08, called d4o0va1