SCOPe 2.03: Domain d4nb1a_: 4nb1 A:

Lineage for d4nb1a_ (4nb1 A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (14 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158879] [237200] (2 PDB entries)

8. Domain d4nb1a_: 4nb1 A: [237203]
   automated match to d4jh2a_
   complexed with cys, so4

Details for d4nb1a_

PDB Entry: 4nb1, 1.8 Å

PDB Description: Crystal Structure of FosB from Staphylococcus aureus at 1.80 Angstrom Resolution with L-Cysteine-Cys9 Disulfide

PDB Compounds: (A:) Metallothiol transferase FosB

SCOPe Domain Sequences for d4nb1a_:

Sequence, based on SEQRES records:

>d4nb1a_ d.32.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]}
hmlksinhicfsvrnlndsihfyrdillgkllltgkktayfelaglwialneekdiprne
ihfsythiaftiddsefkywhqrlkdnnvnilegrvrdirdrqsiyftdpdghklelhtg
tlenrlnyykeakphmtfyk

Sequence, based on observed residues (ATOM records):

>d4nb1a_ d.32.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]}
hmlksinhicfsvrnlndsihfyrdillgkllltgkktayfelaglwialneehfsythi
aftiddsefkywhqrlkdnnvnileqsiyftdpdghklelhtgtlenrlnyakphmtfyk

Timeline for d4nb1a_:

• d4nb1a_ is new in SCOPe 2.03-stable
  
• d4nb1a_ appears in SCOPe 2.04
  
• d4nb1a_ appears in the current release, SCOPe 2.08, called d4nb1a1