SCOPe 2.05: Domain d1ciya1: 1ciy A:462-609

Lineage for d1ciya1 (1ciy A:462-609)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.3: delta-Endotoxin, C-terminal domain [49796] (1 protein)
   automatically mapped to Pfam PF03944

6. Protein delta-Endotoxin, C-terminal domain [49797] (5 species)

7. Species Bacillus thuringiensis, CRYIA (A) [TaxId:1428] [49799] (1 PDB entry)

8. Domain d1ciya1: 1ciy A:462-609 [23720]
   Other proteins in same PDB: d1ciya2, d1ciya3

Details for d1ciya1

PDB Entry: 1ciy, 2.25 Å

PDB Description: insecticidal toxin: structure and channel formation

PDB Compounds: (A:) cryia(a)

SCOPe Domain Sequences for d1ciya1:

Sequence; same for both SEQRES and ATOM records:

>d1ciya1 b.18.1.3 (A:462-609) delta-Endotoxin, C-terminal domain {Bacillus thuringiensis, CRYIA (A) [TaxId: 1428]}
nniipssqitqipltkstnlgsgtsvvkgpgftggdilrrtspgqistlrvnitaplsqr
yrvriryasttnlqfhtsidgrpinqgnfsatmssgsnlqsgsfrtvgfttpfnfsngss
vftlsahvfnsgnevyidriefvpaevt

Timeline for d1ciya1:

• d1ciya1 first appeared (with stable ids) in SCOP 1.55, called d1ciy_1
  
• d1ciya1 appears in SCOPe 2.04
  
• d1ciya1 appears in SCOPe 2.06
  
• d1ciya1 appears in the current release, SCOPe 2.08