SCOPe 2.03: Domain d4muma1: 4mum A:34-233

Lineage for d4muma1 (4mum A:34-233)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.8: 5'(3')-deoxyribonucleotidase (dNT-2) [82382] (2 proteins)
   the insertion subdomain is a 4-helical bundle; dephosphorylates dUMP and dTMP
   automatically mapped to Pfam PF06941

6. Protein automated matches [190171] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186899] (12 PDB entries)

8. Domain d4muma1: 4mum A:34-233 [237199]
   automated match to d2i7da_
   complexed with cl, gol, mg, peg, pg4, po4, trs

Details for d4muma1

PDB Entry: 4mum, 1.27 Å

PDB Description: Crystal structure of mitochondrial 5'(3')-deoxy ribonucleotidase alternative spliced variant

PDB Compounds: (A:) Mitochondrial 5' nucleotidase

SCOPe Domain Sequences for d4muma1:

Sequence, based on SEQRES records:

>d4muma1 c.108.1.8 (A:34-233) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ralrvlvdmdgvladfeggflrkfrarfpdqpfialedrrgfwvseqygrlrpglsekai
siwesknfffeleplpgaveavkemaslqntdvfictspikmfkycpyekyawvekyfgp
dfleqivltrdktvvsadlliddrpditgkwpatgaeptpswehvlftachnqhlqlqpp
rrrlhswaddwkaildskrp

Sequence, based on observed residues (ATOM records):

>d4muma1 c.108.1.8 (A:34-233) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ralrvlvdmdgvladfeggflrkfrarfpdqpfialedrrgfwvseqygrlrpglsekai
siwesknfffeleplpgaveavkemaslqntdvfictspikmfkycpyekyawvekyfgp
dfleqivltrdktvvsadlliddrpditgtgaeptpswehvlftachnqhlqlqpprrrl
hswaddwkaildskrp

Timeline for d4muma1:

• d4muma1 is new in SCOPe 2.03-stable
  
• d4muma1 appears in SCOPe 2.04
  
• d4muma1 appears in the current release, SCOPe 2.08