Class a: All alpha proteins [46456] (284 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
Protein automated matches [226859] (26 species) not a true protein |
Species Pseudoalteromonas haloplanktis [TaxId:326442] [225959] (4 PDB entries) |
Domain d4l2dd1: 4l2d D:1-82 [237192] Other proteins in same PDB: d4l2da2, d4l2db2, d4l2dc2, d4l2dd2 automated match to d3lioa1 complexed with fe2, tre |
PDB Entry: 4l2d (more details), 2.07 Å
SCOPe Domain Sequences for d4l2dd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l2dd1 a.2.11.0 (D:1-82) automated matches {Pseudoalteromonas haloplanktis [TaxId: 326442]} afelpslpyaidalephisketlefhhgkhhntyvvklnglipgtkfenksleeivcssd ggvfnnaaqiwnhtfywnslsp
Timeline for d4l2dd1: