Lineage for d4l2dd1 (4l2d D:1-82)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690339Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2690340Protein automated matches [226859] (39 species)
    not a true protein
  7. 2690543Species Pseudoalteromonas haloplanktis [TaxId:326442] [225959] (4 PDB entries)
  8. 2690549Domain d4l2dd1: 4l2d D:1-82 [237192]
    Other proteins in same PDB: d4l2da2, d4l2db2, d4l2dc2, d4l2dd2
    automated match to d3lioa1
    complexed with fe2

Details for d4l2dd1

PDB Entry: 4l2d (more details), 2.07 Å

PDB Description: x-ray structure of the fe(ii) form of the iron superoxide dismutase from pseudoalteromonas haloplanktis
PDB Compounds: (D:) superoxide dismutase [fe]

SCOPe Domain Sequences for d4l2dd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l2dd1 a.2.11.0 (D:1-82) automated matches {Pseudoalteromonas haloplanktis [TaxId: 326442]}
afelpslpyaidalephisketlefhhgkhhntyvvklnglipgtkfenksleeivcssd
ggvfnnaaqiwnhtfywnslsp

SCOPe Domain Coordinates for d4l2dd1:

Click to download the PDB-style file with coordinates for d4l2dd1.
(The format of our PDB-style files is described here.)

Timeline for d4l2dd1: