Lineage for d1dlca1 (1dlc A:500-644)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776981Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1776982Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 1777046Family b.18.1.3: delta-Endotoxin, C-terminal domain [49796] (1 protein)
    automatically mapped to Pfam PF03944
  6. 1777047Protein delta-Endotoxin, C-terminal domain [49797] (5 species)
  7. 1777050Species Bacillus thuringiensis tenebrionis, CRYIIIA (BT13) [TaxId:1444] [49798] (1 PDB entry)
  8. 1777051Domain d1dlca1: 1dlc A:500-644 [23719]
    Other proteins in same PDB: d1dlca2, d1dlca3

Details for d1dlca1

PDB Entry: 1dlc (more details), 2.5 Å

PDB Description: crystal structure of insecticidal delta-endotoxin from bacillus thuringiensis at 2.5 angstroms resolution
PDB Compounds: (A:) delta-endotoxin cryiiia

SCOPe Domain Sequences for d1dlca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlca1 b.18.1.3 (A:500-644) delta-Endotoxin, C-terminal domain {Bacillus thuringiensis tenebrionis, CRYIIIA (BT13) [TaxId: 1444]}
ffnmidskkitqlplvkayklqsgasvvagprftggdiiqctengsaatiyvtpdvsysq
kyrarihyastsqitftlsldgapfnqyyfdktinkgdtltynsfnlasfstpfelsgnn
lqigvtglsagdkvyidkiefipvn

SCOPe Domain Coordinates for d1dlca1:

Click to download the PDB-style file with coordinates for d1dlca1.
(The format of our PDB-style files is described here.)

Timeline for d1dlca1: