SCOPe 2.06: Domain d4l2ca2: 4l2c A:83-192

Lineage for d4l2ca2 (4l2c A:83-192)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (31 species)
   not a true protein

7. Species Pseudoalteromonas haloplanktis [TaxId:228] [237182] (3 PDB entries)

8. Domain d4l2ca2: 4l2c A:83-192 [237183]
   Other proteins in same PDB: d4l2ca1, d4l2cb1, d4l2cc1, d4l2cd1
   automated match to d2p4ka2
   complexed with fe, tre; mutant

Details for d4l2ca2

PDB Entry: 4l2c, 1.66 Å

PDB Description: x-ray structure of the c57r mutant of the iron superoxide dismutase from pseudoalteromonas haloplanktis (crystal form i)

PDB Compounds: (A:) superoxide dismutase [fe]

SCOPe Domain Sequences for d4l2ca2:

Sequence; same for both SEQRES and ATOM records:

>d4l2ca2 d.44.1.0 (A:83-192) automated matches {Pseudoalteromonas haloplanktis [TaxId: 228]}
ngggaptgavadainakwgsfdafkealndkavnnfgsswtwlvkladgsldivntsnaa
tpltddgvtpiltvdlwehayyidyrnvrpdylkgfwslvnwefananfa

Timeline for d4l2ca2:

• d4l2ca2 first appeared in SCOPe 2.03
  
• d4l2ca2 appears in SCOPe 2.05
  
• d4l2ca2 appears in SCOPe 2.07
  
• d4l2ca2 appears in the current release, SCOPe 2.08