Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (83 species) not a true protein |
Species Xanthomonas oryzae [TaxId:291331] [189393] (4 PDB entries) |
Domain d4ixzb_: 4ixz B: [237151] automated match to d4ixsa_ complexed with bct, bme, gol |
PDB Entry: 4ixz (more details), 2.07 Å
SCOPe Domain Sequences for d4ixzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ixzb_ c.67.1.0 (B:) automated matches {Xanthomonas oryzae [TaxId: 291331]} alslatlaihggqspdpstgavmppiyatstyaqsspgehqgfeysrthnptrfayercv aaleggtrafafasgmaatstvmelldagshvvamddlyggtfrlfervrrrtagldfsf vdltdpaafkaairadtkmvwietptnpmlklvdiaaiaviarkhglltvvdntfaspml qrplslgadlvvhsatkylnghsdmvggiavvgdnaelaeqmaflqnsiggvqgpfdsfl alrglktlplrmrahcenalalaqwlethpaiekviypglashpqhvlakrqmsgfggiv sivlkggfdaakrfcektelftlaeslggveslvnhpavmthasipvarreqlgisdalv rlsvgiedlgdlrgdleralv
Timeline for d4ixzb_: