Lineage for d4cmma_ (4cmm A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1295895Species Homo sapiens [TaxId:9606] [230172] (40 PDB entries)
  8. 1295918Domain d4cmma_: 4cmm A: [237121]
    automated match to d2jjwa_
    complexed with nag

Details for d4cmma_

PDB Entry: 4cmm (more details), 1.92 Å

PDB Description: structure of human cd47 in complex with human signal regulatory protein (sirp) alpha v1
PDB Compounds: (A:) tyrosine-protein phosphatase non-receptor type substrate 1

SCOPe Domain Sequences for d4cmma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cmma_ b.1.1.0 (A:) automated matches {Homo sapiens [TaxId: 9606]}
elqviqpdksvlvaagetatlrctatslipvgpiqwfrgagpgreliynqkeghfprvtt
vsdltkrnnmdfsirignitpadagtyycvkfrkgspddvefksgagtelsvrakps

SCOPe Domain Coordinates for d4cmma_:

Click to download the PDB-style file with coordinates for d4cmma_.
(The format of our PDB-style files is described here.)

Timeline for d4cmma_: