SCOPe 2.03: Domain d4c2va_: 4c2v A:

Lineage for d4c2va_ (4c2v A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (18 species)
   not a true protein

7. Species Xenopus laevis [TaxId:8355] [237113] (2 PDB entries)

8. Domain d4c2va_: 4c2v A: [237116]
   Other proteins in same PDB: d4c2vb_
   automated match to d3kk8a_
   complexed with yja

Details for d4c2va_

PDB Entry: 4c2v, 1.49 Å

PDB Description: Aurora B kinase in complex with the specific inhibitor Barasertib

PDB Compounds: (A:) aurora kinase b-a

SCOPe Domain Sequences for d4c2va_:

Sequence; same for both SEQRES and ATOM records:

>d4c2va_ d.144.1.0 (A:) automated matches {Xenopus laevis [TaxId: 8355]}
kftiddfdigrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehqlrreieiqs
hlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfmeeladalhy
cherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylppemiegkth
dekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgskdliskllry
hppqrlplkgvmehpwvkansrrvlppvyqs

Timeline for d4c2va_:

• d4c2va_ is new in SCOPe 2.03-stable
  
• d4c2va_ appears in SCOPe 2.04
  
• d4c2va_ appears in the current release, SCOPe 2.08