SCOPe 2.08: Domain d4c2wb_: 4c2w B:

Lineage for d4c2wb_ (4c2w B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (37 species)
   not a true protein

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [237113] (2 PDB entries)

8. Domain d4c2wb_: 4c2w B: [237115]
   automated match to d3kk8a_
   complexed with anp

Details for d4c2wb_

PDB Entry: 4c2w, 1.7 Å

PDB Description: Crystal structure of Aurora B in complex with AMP-PNP

PDB Compounds: (B:) aurora kinase b-a

SCOPe Domain Sequences for d4c2wb_:

Sequence; same for both SEQRES and ATOM records:

>d4c2wb_ d.144.1.0 (B:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
talaempkrkftiddfdigrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehq
lrreieiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfm
eeladalhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylp
pemiegkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgsk
dliskllryhppqrlplkgvmehpwvkansrrvlppvy

Timeline for d4c2wb_:

• d4c2wb_ first appeared in SCOPe 2.03
  
• d4c2wb_ appears in SCOPe 2.07