Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (37 species) not a true protein |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [237113] (2 PDB entries) |
Domain d4c2wb_: 4c2w B: [237115] automated match to d3kk8a_ complexed with anp |
PDB Entry: 4c2w (more details), 1.7 Å
SCOPe Domain Sequences for d4c2wb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c2wb_ d.144.1.0 (B:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]} talaempkrkftiddfdigrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehq lrreieiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfm eeladalhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylp pemiegkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgsk dliskllryhppqrlplkgvmehpwvkansrrvlppvy
Timeline for d4c2wb_: