Lineage for d4bzsb_ (4bzs B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2530179Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2530180Protein automated matches [190805] (17 species)
    not a true protein
  7. 2530208Species Human (Homo sapiens) [TaxId:9606] [188286] (57 PDB entries)
  8. 2530258Domain d4bzsb_: 4bzs B: [237110]
    automated match to d3nxqb_
    complexed with 9x6, cl, k26, p6g, pe4, peg, pg4, zn

Details for d4bzsb_

PDB Entry: 4bzs (more details), 2.1 Å

PDB Description: human angiotenisn converting enzyme n-domain in complex with k-26
PDB Compounds: (B:) angiotensin-converting enzyme

SCOPe Domain Sequences for d4bzsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bzsb_ d.92.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldpglqpgnfsadeagaqlfaqsynssaeqvlfqsvaaswahdtnitaenarrqeeaall
sqefaeawgqkakelyepiwqnftdpqlrriigavrtlgsanlplakrqqynallsnmsr
iystakvclpnktatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedfta
lsneaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdr
yinlrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwnathmfrvaeef
ftslelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvh
hemghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtes
dinyllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrn
ethfdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagakl
rkvlqagssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwh
pplpdnypeg

SCOPe Domain Coordinates for d4bzsb_:

Click to download the PDB-style file with coordinates for d4bzsb_.
(The format of our PDB-style files is described here.)

Timeline for d4bzsb_: