Class b: All beta proteins [48724] (177 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.1: Galactose-binding domain [49786] (2 proteins) automatically mapped to Pfam PF00754 |
Protein Galactose oxidase, N-terminal domain [49787] (3 species) |
Species Dactylium dendroides [TaxId:5132] [49788] (3 PDB entries) Uniprot Q01745 42-680 |
Domain d1goha2: 1goh A:1-150 [23711] Other proteins in same PDB: d1goha1, d1goha3 complexed with na |
PDB Entry: 1goh (more details), 2.2 Å
SCOPe Domain Sequences for d1goha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1goha2 b.18.1.1 (A:1-150) Galactose oxidase, N-terminal domain {Dactylium dendroides [TaxId: 5132]} asapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangdpkpphtytidmk ttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasgswfadsttkysnfetrp aryvrlvaiteangqpwtsiaeinvfqass
Timeline for d1goha2: