SCOPe 2.05: Domain d4nztl2: 4nzt L:108-212

Lineage for d4nztl2 (4nzt L:108-212)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)

8. Domain d4nztl2: 4nzt L:108-212 [237109]
   Other proteins in same PDB: d4nztl1
   automated match to d4fqhb2

Details for d4nztl2

PDB Entry: 4nzt, 2.5 Å

PDB Description: Crystal structure of the antibody-binding region of Protein M (Protein M TD) in complex with anti-infleunza hemagglutinin antibody CR9114 Fab

PDB Compounds: (L:) CR9114 light chain

SCOPe Domain Sequences for d4nztl2:

Sequence; same for both SEQRES and ATOM records:

>d4nztl2 b.1.1.2 (L:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

Timeline for d4nztl2:

• d4nztl2 first appeared in SCOPe 2.03
  
• d4nztl2 appears in SCOPe 2.04
  
• d4nztl2 appears in SCOPe 2.06
  
• d4nztl2 appears in the current release, SCOPe 2.08