SCOPe 2.03: Domain d4nw5a1: 4nw5 A:51-346

Lineage for d4nw5a1 (4nw5 A:51-346)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (314 PDB entries)

8. Domain d4nw5a1: 4nw5 A:51-346 [237098]
   automated match to d3g51a_
   complexed with 2nr

Details for d4nw5a1

PDB Entry: 4nw5, 1.94 Å

PDB Description: Rsk2 N-terminal kinase in complex with 2-amino-7-substituted benzoxazole compound 8

PDB Compounds: (A:) Ribosomal protein S6 kinase alpha-3

SCOPe Domain Sequences for d4nw5a1:

Sequence; same for both SEQRES and ATOM records:

>d4nw5a1 d.144.1.0 (A:51-346) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aithhvkeghekadpsqfellkvlgqgsfgkvflvkkisgsdarqlyamkvlkkatlkvr
drvrtkmerdilvevnhpfivklhyafqtegklylildflrggdlftrlskevmfteedv
kfylaelalaldhlhslgiiyrdlkpenilldeeghikltdfglskesidhekkaysfcg
tveymapevvnrrghtqsadwwsfgvlmfemltgtlpfqgkdrketmtmilkaklgmpqf
lspeaqsllrmlfkrnpanrlgagpdgveeikrhsffstidwnklyrreihppfkp

Timeline for d4nw5a1:

• d4nw5a1 is new in SCOPe 2.03-stable
  
• d4nw5a1 appears in SCOPe 2.04
  
• d4nw5a1 appears in the current release, SCOPe 2.08