SCOPe 2.08: Domain d4oq4a1: 4oq4 A:4-188

Lineage for d4oq4a1 (4oq4 A:4-188)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
   contains a catalytic triad or dyad different from the class I GAT triad

6. Protein DJ-1 [89603] (1 species)
   RNA-binding protein regulatory subunit

7. Species Human (Homo sapiens) [TaxId:9606] [89604] (62 PDB entries)
   Uniprot Q99497

8. Domain d4oq4a1: 4oq4 A:4-188 [237093]
   Other proteins in same PDB: d4oq4a2
   automated match to d1q2ua_
   complexed with na

Details for d4oq4a1

PDB Entry: 4oq4, 1.49 Å

PDB Description: Crystal Structure of E18A Human DJ-1

PDB Compounds: (A:) Protein DJ-1

SCOPe Domain Sequences for d4oq4a1:

Sequence; same for both SEQRES and ATOM records:

>d4oq4a1 c.23.16.2 (A:4-188) DJ-1 {Human (Homo sapiens) [TaxId: 9606]}
kralvilakgaeematvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasledakk
egpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfgskv
tthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaqvka
plvlk

Timeline for d4oq4a1:

• d4oq4a1 first appeared in SCOPe 2.03, called d4oq4a_
  
• d4oq4a1 appears in SCOPe 2.07