SCOPe 2.03: Domain d4ntxc_: 4ntx C:

Lineage for d4ntxc_ (4ntx C:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.0: automated matches [194891] (1 protein)
   not a true family

6. Protein automated matches [194892] (2 species)
   not a true protein

7. Species Micrurus tener [TaxId:1114302] [237091] (3 PDB entries)

8. Domain d4ntxc_: 4ntx C: [237092]
   Other proteins in same PDB: d4ntxb_
   automated match to d1a3da_
   complexed with amr, cl, na, nag, p6g

Details for d4ntxc_

PDB Entry: 4ntx, 2.27 Å

PDB Description: structure of acid-sensing ion channel in complex with snake toxin and amiloride

PDB Compounds: (C:) Basic phospholipase A2 homolog Tx-beta

SCOPe Domain Sequences for d4ntxc_:

Sequence; same for both SEQRES and ATOM records:

>d4ntxc_ a.133.1.0 (C:) automated matches {Micrurus tener [TaxId: 1114302]}
nlnqfrlmikctndrvwadfvdygcycvardsntpvddldrccqaqkqcydeavkvhgck
plvmfysfecrylasdldcsgnntkcrnfvcncdrtatlciltatynrnnhkidpsrc

Timeline for d4ntxc_:

• d4ntxc_ is new in SCOPe 2.03-stable
  
• d4ntxc_ appears in SCOPe 2.04
  
• d4ntxc_ appears in the current release, SCOPe 2.08