Lineage for d1gofa2 (1gof A:1-150)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 662025Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 662026Superfamily b.18.1: Galactose-binding domain-like [49785] (30 families) (S)
  5. 662027Family b.18.1.1: Galactose-binding domain [49786] (2 proteins)
  6. 662028Protein Galactose oxidase, N-terminal domain [49787] (2 species)
  7. 662029Species Dactylium dendroides [TaxId:5132] [49788] (4 PDB entries)
  8. 662030Domain d1gofa2: 1gof A:1-150 [23709]
    Other proteins in same PDB: d1gofa1, d1gofa3
    complexed with acy, cu, na

Details for d1gofa2

PDB Entry: 1gof (more details), 1.7 Å

PDB Description: novel thioether bond revealed by a 1.7 angstroms crystal structure of galactose oxidase
PDB Compounds: (A:) Galactose oxidase

SCOP Domain Sequences for d1gofa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gofa2 b.18.1.1 (A:1-150) Galactose oxidase, N-terminal domain {Dactylium dendroides [TaxId: 5132]}
asapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangdpkpphtytidmk
ttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasgswfadsttkysnfetrp
aryvrlvaiteangqpwtsiaeinvfqass

SCOP Domain Coordinates for d1gofa2:

Click to download the PDB-style file with coordinates for d1gofa2.
(The format of our PDB-style files is described here.)

Timeline for d1gofa2: