SCOPe 2.07: Domain d4ncc11: 4ncc 1:1-106

Lineage for d4ncc11 (4ncc 1:1-106)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d4ncc11: 4ncc 1:1-106 [237080]
   Other proteins in same PDB: d4ncc12, d4nccl2
   automated match to d1l7tl1

Details for d4ncc11

PDB Entry: 4ncc, 2.49 Å

PDB Description: Neutralizing antibody to murine norovirus

PDB Compounds: (1:) Fab fragment light

SCOPe Domain Sequences for d4ncc11:

Sequence; same for both SEQRES and ATOM records:

>d4ncc11 b.1.1.0 (1:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qivltqspaimsaspgekvtitcsasssvsymhwfqqkpgtspklwiystsnlasgvpar
fsgsgsgtsysltisrmeaedaatyycqqrssypftfgggtkleik

Timeline for d4ncc11:

• d4ncc11 first appeared in SCOPe 2.03
  
• d4ncc11 appears in SCOPe 2.06
  
• d4ncc11 appears in the current release, SCOPe 2.08