Lineage for d4n1fa_ (4n1f A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2711203Protein automated matches [190064] (21 species)
    not a true protein
  7. 2711339Species Obelia longissima [TaxId:32570] [237068] (4 PDB entries)
  8. 2711344Domain d4n1fa_: 4n1f A: [237070]
    automated match to d1uhka_
    complexed with czh; mutant

Details for d4n1fa_

PDB Entry: 4n1f (more details), 2.09 Å

PDB Description: Crystal Structure of F88Y obelin mutant from Obelia longissima at 2.09 Angstrom resolution
PDB Compounds: (A:) obelin

SCOPe Domain Sequences for d4n1fa_:

Sequence, based on SEQRES records: (download)

>d4n1fa_ a.39.1.5 (A:) automated matches {Obelia longissima [TaxId: 32570]}
avklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqtkrhq
vcveaffrgcgmeygkeiafpqyldgwkqlatselkkwarneptlirewgdavfdifdkd
gsgtitldewkaygkisgispsqedceatfrhcdldnsgdldvdemtrqhlgfwytldpe
adglygngvp

Sequence, based on observed residues (ATOM records): (download)

>d4n1fa_ a.39.1.5 (A:) automated matches {Obelia longissima [TaxId: 32570]}
avklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqtkrhq
vcveaffrgcgmeygkeiafpqyldgwkqlatselkkwarneptlirewgdavfdifdgt
itldewkaygkisgispsqedceatfrhcdldnsgdldvdemtrqhlgfwytldpeadgl
ygngvp

SCOPe Domain Coordinates for d4n1fa_:

Click to download the PDB-style file with coordinates for d4n1fa_.
(The format of our PDB-style files is described here.)

Timeline for d4n1fa_: