Class a: All alpha proteins [46456] (290 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein automated matches [190064] (21 species) not a true protein |
Species Obelia longissima [TaxId:32570] [237068] (4 PDB entries) |
Domain d4n1fa_: 4n1f A: [237070] automated match to d1uhka_ complexed with czh; mutant |
PDB Entry: 4n1f (more details), 2.09 Å
SCOPe Domain Sequences for d4n1fa_:
Sequence, based on SEQRES records: (download)
>d4n1fa_ a.39.1.5 (A:) automated matches {Obelia longissima [TaxId: 32570]} avklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqtkrhq vcveaffrgcgmeygkeiafpqyldgwkqlatselkkwarneptlirewgdavfdifdkd gsgtitldewkaygkisgispsqedceatfrhcdldnsgdldvdemtrqhlgfwytldpe adglygngvp
>d4n1fa_ a.39.1.5 (A:) automated matches {Obelia longissima [TaxId: 32570]} avklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqtkrhq vcveaffrgcgmeygkeiafpqyldgwkqlatselkkwarneptlirewgdavfdifdgt itldewkaygkisgispsqedceatfrhcdldnsgdldvdemtrqhlgfwytldpeadgl ygngvp
Timeline for d4n1fa_: