SCOPe 2.04: Domain d4me6a1: 4me6 A:2-139

Lineage for d4me6a1 (4me6 A:2-139)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (9 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (25 species)
   not a true protein

7. Species Xanthomonas oryzae [TaxId:342109] [225704] (4 PDB entries)

8. Domain d4me6a1: 4me6 A:2-139 [237066]
   Other proteins in same PDB: d4me6a2
   automated match to d3e5na1
   complexed with adp, mg

Details for d4me6a1

PDB Entry: 4me6, 2.1 Å

PDB Description: Crystal structure of D-alanine-D-alanine ligase A from Xanthomonas oryzae pathovar oryzae with ADP

PDB Compounds: (A:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d4me6a1:

Sequence, based on SEQRES records:

>d4me6a1 c.30.1.0 (A:2-139) automated matches {Xanthomonas oryzae [TaxId: 342109]}
rkirvglifggksaehevslqsarnildaldpqrfepvligidkqgqwhvndpdsfllha
ddparialhrsgrgvallpgaqqqqlrpiqpeqalaqidvvfpivhgtlgedgslqgllr
manlpfvgsgvlgsavam

Sequence, based on observed residues (ATOM records):

>d4me6a1 c.30.1.0 (A:2-139) automated matches {Xanthomonas oryzae [TaxId: 342109]}
rkirvglifggksaehevslqsarnildaldpqrfepvligidkqgqwhvndpdsfllha
ddparialhrsgrgvallpgaqqqqlrpiqaqidvvfpivhgtlgedgslqgllrmanlp
fvgsgvlgsavam

Timeline for d4me6a1:

• d4me6a1 first appeared in SCOPe 2.03
  
• d4me6a1 appears in SCOPe 2.05
  
• d4me6a1 appears in the current release, SCOPe 2.08