Class b: All beta proteins [48724] (174 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.0: automated matches [191560] (1 protein) not a true family |
Protein automated matches [190967] (25 species) not a true protein |
Species Neisseria gonorrhoeae [TaxId:242231] [235544] (2 PDB entries) |
Domain d4m99c_: 4m99 C: [237065] automated match to d4m99a_ complexed with aco, na |
PDB Entry: 4m99 (more details), 2.6 Å
SCOPe Domain Sequences for d4m99c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m99c_ b.81.1.0 (C:) automated matches {Neisseria gonorrhoeae [TaxId: 242231]} gnrklavigagghgkvvaelaaalgtygeivflddrtqgsvngfpvigttlllenslspe qfditvavgnnrirrqitenaaalgfklpvlihpdatvspsaiigqgsvvmakavvqags vlkdgvivntaatvdhdclldafvhispgahlsgntrigeesrigtgacsrqqttvgsgv tagagavivcdipdgmtvagnpakpl
Timeline for d4m99c_: