SCOPe 2.03: Domain d4lagx_: 4lag X:

Lineage for d4lagx_ (4lag X:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (8 species)

7. Species Staphylococcus aureus [TaxId:1280] [188976] (20 PDB entries)

8. Domain d4lagx_: 4lag X: [237056]
   automated match to d3sqyx_
   complexed with 1vn, nap

Details for d4lagx_

PDB Entry: 4lag, 1.7 Å

PDB Description: Structure-Based Design of New Dihydrofolate Reductase Antibacterial Agents: 7-(Benzimidazol-1-yl)-2,4-diaminoquinazolines

PDB Compounds: (X:) dihydrofolate reductase

SCOPe Domain Sequences for d4lagx_:

Sequence; same for both SEQRES and ATOM records:

>d4lagx_ c.71.1.1 (X:) Dihydrofolate reductase, prokaryotic type {Staphylococcus aureus [TaxId: 1280]}
tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirk

Timeline for d4lagx_:

• d4lagx_ is new in SCOPe 2.03-stable
  
• d4lagx_ appears in SCOPe 2.04
  
• d4lagx_ appears in the current release, SCOPe 2.08