SCOPe 2.05: Domain d4l85a_: 4l85 A:

Lineage for d4l85a_ (4l85 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (59 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [225766] (2 PDB entries)

8. Domain d4l85a_: 4l85 A: [237052]
   automated match to d1zh4a_
   complexed with iod; mutant

Details for d4l85a_

PDB Entry: 4l85, 2.2 Å

PDB Description: Crystal structure of receiver domain of KdpE D52A mutant from E. coli

PDB Compounds: (A:) KDP operon transcriptional regulatory protein kdpE

SCOPe Domain Sequences for d4l85a_:

Sequence, based on SEQRES records:

>d4l85a_ c.23.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
gamanvlivedeqairrflrtalegdgmrvfeaetlqrglleaatrkpdliilalglpdg
dgiefirdlrqwsavpvivlsarseesdkiaaldagaddylskpfgigelqarlrvalrr
h

Sequence, based on observed residues (ATOM records):

>d4l85a_ c.23.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
gamanvlivedeqairrflrtalegdgmrvfeaetlqrglleaatrkpdliilalggief
irdlrqwsavpvivlsarseesdkiaaldagaddylskpfgigelqarlrvalrrh

Timeline for d4l85a_:

• d4l85a_ first appeared in SCOPe 2.03
  
• d4l85a_ appears in SCOPe 2.04
  
• d4l85a_ is called d4l85a1 in SCOPe 2.06
  
• d4l85a_ appears in the current release, SCOPe 2.08, called d4l85a1