Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (48 species) not a true protein |
Species Escherichia coli [TaxId:83333] [225766] (2 PDB entries) |
Domain d4l85a_: 4l85 A: [237052] automated match to d1zh4a_ complexed with iod; mutant |
PDB Entry: 4l85 (more details), 2.2 Å
SCOPe Domain Sequences for d4l85a_:
Sequence, based on SEQRES records: (download)
>d4l85a_ c.23.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]} gamanvlivedeqairrflrtalegdgmrvfeaetlqrglleaatrkpdliilalglpdg dgiefirdlrqwsavpvivlsarseesdkiaaldagaddylskpfgigelqarlrvalrr h
>d4l85a_ c.23.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]} gamanvlivedeqairrflrtalegdgmrvfeaetlqrglleaatrkpdliilalggief irdlrqwsavpvivlsarseesdkiaaldagaddylskpfgigelqarlrvalrrh
Timeline for d4l85a_: