Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
Superfamily d.166.1: ADP-ribosylation [56399] (8 families) |
Family d.166.1.0: automated matches [191650] (1 protein) not a true family |
Protein automated matches [191197] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225406] (38 PDB entries) |
Domain d4l7na2: 4l7n A:322-532 [237043] Other proteins in same PDB: d4l7na1, d4l7na3 automated match to d3c49a2 complexed with 1vb |
PDB Entry: 4l7n (more details), 1.8 Å
SCOPe Domain Sequences for d4l7na2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l7na2 d.166.1.0 (A:322-532) automated matches {Human (Homo sapiens) [TaxId: 9606]} lkcqlqlldsgapeykviqtyleqtgsnhrcptlqhiwkvnqegeedrfqahsklgnrkl lwhgtnmavvaailtsglrimphsggrvgkgiyfasensksagyvigmkcgahhvgymfl gevalgrehhintdnpslkspppgfdsviarghtepdptqdteleldgqqvvvpqgqpvp cpefssstfsqseyliyqesqcrlryllevh
Timeline for d4l7na2: