Lineage for d4l7na2 (4l7n A:322-532)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2233860Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2233861Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2234147Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 2234148Protein automated matches [191197] (9 species)
    not a true protein
  7. 2234201Species Human (Homo sapiens) [TaxId:9606] [225406] (38 PDB entries)
  8. 2234205Domain d4l7na2: 4l7n A:322-532 [237043]
    Other proteins in same PDB: d4l7na1, d4l7na3
    automated match to d3c49a2
    complexed with 1vb

Details for d4l7na2

PDB Entry: 4l7n (more details), 1.8 Å

PDB Description: Human artd3 (parp3) - catalytic domain in complex with inhibitor STO1542
PDB Compounds: (A:) Poly [ADP-ribose] polymerase 3

SCOPe Domain Sequences for d4l7na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l7na2 d.166.1.0 (A:322-532) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lkcqlqlldsgapeykviqtyleqtgsnhrcptlqhiwkvnqegeedrfqahsklgnrkl
lwhgtnmavvaailtsglrimphsggrvgkgiyfasensksagyvigmkcgahhvgymfl
gevalgrehhintdnpslkspppgfdsviarghtepdptqdteleldgqqvvvpqgqpvp
cpefssstfsqseyliyqesqcrlryllevh

SCOPe Domain Coordinates for d4l7na2:

Click to download the PDB-style file with coordinates for d4l7na2.
(The format of our PDB-style files is described here.)

Timeline for d4l7na2: