Lineage for d4cq1c2 (4cq1 C:445-531)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1415602Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1416109Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 1416110Protein automated matches [190896] (3 species)
    not a true protein
  7. 1416117Species Human (Homo sapiens) [TaxId:9606] [188315] (18 PDB entries)
  8. 1416124Domain d4cq1c2: 4cq1 C:445-531 [237001]
    Other proteins in same PDB: d4cq1a1, d4cq1b1, d4cq1c1, d4cq1d1, d4cq1e1, d4cq1f1, d4cq1g1, d4cq1h1
    automated match to d4ckob2
    complexed with cl, zn

Details for d4cq1c2

PDB Entry: 4cq1 (more details), 1.69 Å

PDB Description: crystal structure of the neuronal isoform of ptb
PDB Compounds: (C:) polypyrimidine tract-binding protein 2

SCOPe Domain Sequences for d4cq1c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cq1c2 d.58.7.0 (C:445-531) automated matches {Human (Homo sapiens) [TaxId: 9606]}
knfqnifppsatlhlsnippsvaeedlrtlfantggtvkafkffqdhkmallqmatveea
iqalidlhnynlgenhhlrvsfsksti

SCOPe Domain Coordinates for d4cq1c2:

Click to download the PDB-style file with coordinates for d4cq1c2.
(The format of our PDB-style files is described here.)

Timeline for d4cq1c2: