Lineage for d4grwg_ (4grw G:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512732Protein automated matches [190119] (19 species)
    not a true protein
  7. 1513180Species Llama glama [TaxId:9844] [236993] (1 PDB entry)
  8. 1513183Domain d4grwg_: 4grw G: [236997]
    automated match to d1vhpa_

Details for d4grwg_

PDB Entry: 4grw (more details), 2.55 Å

PDB Description: structure of a complex of human il-23 with 3 nanobodies (llama vhhs)
PDB Compounds: (G:) Nanobody 124C4

SCOPe Domain Sequences for d4grwg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4grwg_ b.1.1.1 (G:) automated matches {Llama glama [TaxId: 9844]}
evqlvesggglvqpggslrlscaasgftlddyaiawfrqapgkeregvsgidsgdgsayy
adsvkgrftissdnakntvylqmnslrpedtavyycarvrtgwglnapdyamdywgkgtl
vtvss

SCOPe Domain Coordinates for d4grwg_:

Click to download the PDB-style file with coordinates for d4grwg_.
(The format of our PDB-style files is described here.)

Timeline for d4grwg_: