Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
Protein automated matches [190332] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187155] (22 PDB entries) |
Domain d4cq1c1: 4cq1 C:337-444 [236985] Other proteins in same PDB: d4cq1a2, d4cq1b2, d4cq1c2, d4cq1d2, d4cq1e2, d4cq1f2, d4cq1g2, d4cq1h2 automated match to d4ckob1 complexed with cl, zn |
PDB Entry: 4cq1 (more details), 1.69 Å
SCOPe Domain Sequences for d4cq1c1:
Sequence, based on SEQRES records: (download)
>d4cq1c1 d.58.7.1 (C:337-444) automated matches {Human (Homo sapiens) [TaxId: 9606]} ntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhln gqkmygkiirvtlskhqtvqlpreglddqgltkdfgnsplhrfkkpgs
>d4cq1c1 d.58.7.1 (C:337-444) automated matches {Human (Homo sapiens) [TaxId: 9606]} ntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhln gqkmygkiirvtlskhqtvqlpgltkdfgnsplhrfkkpgs
Timeline for d4cq1c1: