Lineage for d3zl6b_ (3zl6 B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1281954Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 1281955Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 1282215Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 1282216Protein automated matches [196409] (21 species)
    not a true protein
  7. 1282273Species Pseudomonas aeruginosa [TaxId:208964] [229469] (5 PDB entries)
  8. 1282279Domain d3zl6b_: 3zl6 B: [236956]
    automated match to d3zcda_
    complexed with dms, mg, nvu

Details for d3zl6b_

PDB Entry: 3zl6 (more details), 1.85 Å

PDB Description: native structure of farnesyl pyrophosphate synthase from pseudomonas aeruginosa pao1, with bound fragment km10833.
PDB Compounds: (B:) Geranyltranstransferase

SCOPe Domain Sequences for d3zl6b_:

Sequence, based on SEQRES records: (download)

>d3zl6b_ a.128.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
smiaayqarcqarvdaaldalfvapreelqrlyeamrysvmnggkrvrpllayaacealg
gapqradaaacavelihayslvhddlpamddddlrrgqptthrafdeatailaadglqal
afevladtrrnpqehavclemltrlaraagsagmvggqaidlgsvgvaldqaalevmhrh
ktgalieasvrlgalasgraepaslaaleryaeaiglafqvqddildvesdtatlgktqg
kdqahnkptypallgleaakgyalelrdlalaaldgfppsadplrqlaryive

Sequence, based on observed residues (ATOM records): (download)

>d3zl6b_ a.128.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
smiaayqarcqarvdaaldalfvapreelqrlyeamrysvmnggkrvrpllayaacealg
gapqradaaacavelihayslvhddlpamddddlrrgqptthrafdeatailaadglqal
afevladtrrnpqehavclemltrlaraagsagmvggqaidlgsvgvaldqaalevmhrh
ktgalieasvrlgalasgraepaslaaleryaeaiglafqvqddildvptypallgleaa
kgyalelrdlalaaldgfppsadplrqlaryive

SCOPe Domain Coordinates for d3zl6b_:

Click to download the PDB-style file with coordinates for d3zl6b_.
(The format of our PDB-style files is described here.)

Timeline for d3zl6b_:

  • d3zl6b_ appears in periodic updates to SCOPe 2.03 starting on 2014-02-13
  • d3zl6b_ appears in SCOPe 2.04
  • d3zl6b_ appears in the current release, SCOPe 2.07, called d3zl6b1