SCOPe 2.03: Domain d3whwb_: 3whw B:

Lineage for d3whwb_ (3whw B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 [103207] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103208] (2 PDB entries)

8. Domain d3whwb_: 3whw B: [236953]
   automated match to d1irya_
   complexed with rux, so4

Details for d3whwb_

PDB Entry: 3whw, 2.7 Å

PDB Description: mth1 in complex with ruthenium-based inhibitor

PDB Compounds: (B:) 7,8-dihydro-8-oxoguanine triphosphatase

SCOPe Domain Sequences for d3whwb_:

Sequence; same for both SEQRES and ATOM records:

>d3whwb_ d.113.1.1 (B:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]}
asrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesgltvd
alhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpddsy
wfplllqkkkfhgyfkfqgqdtildytlrevdtv

Timeline for d3whwb_:

• d3whwb_ is new in SCOPe 2.03-stable
  
• d3whwb_ appears in SCOPe 2.04
  
• d3whwb_ appears in the current release, SCOPe 2.08